Atlas Antibodies Anti-HEXIM2 Antibody

상품 한눈에 보기

인간 HEXIM2 단백질을 표적으로 하는 폴리클로날 항체. IHC 및 WB에서 정교한 검증 수행. 토끼 유래 IgG로 제작되었으며, PrEST 항원 친화 정제. 인간에 높은 반응성, 쥐·마우스와 76% 동일성.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028455-100 Anti-HEXIM2 Antibody, hexamethylene bis-acetamide inducible 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028455-25 Anti-HEXIM2 Antibody, hexamethylene bis-acetamide inducible 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: hexamethylene bis-acetamide inducible 2
Supplier: Atlas Antibodies

IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.

Polyclonal antibody against Human HEXIM2

항목	내용
Target Protein	hexamethylene bis-acetamide inducible 2
Target Gene	HEXIM2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000021287 (76%), Mouse ENSMUSG00000043372 (76%)

Antigen Sequence:
ELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand