Atlas Antibodies Anti-HEXIM2 Antibody

상품 한눈에 보기

인간 HEXIM2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 검증된 고품질 항체로, 정제된 PrEST 항원을 사용하여 제작됨. 인간, 마우스, 랫트 간 교차 반응성 확인. 40% 글리세롤 PBS 버퍼에 보존.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA023323-100 Anti-HEXIM2 Antibody, hexamethylene bis-acetamide inducible 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA023323-25 Anti-HEXIM2 Antibody, hexamethylene bis-acetamide inducible 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: hexamethylene bis-acetamide inducible 2
Supplier: Atlas Antibodies

IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant Expression Validation): Recombinant expression validation in WB using target protein overexpression.

Polyclonal Antibody against Human HEXIM2

항목	내용
Target Protein	hexamethylene bis-acetamide inducible 2
Target Gene	HEXIM2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	ELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000043372 (76%), Rat ENSRNOG00000021287 (76%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand