CacheBy
Atlas Antibodies Anti-GYG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GYG1 Antibody

상품 한눈에 보기

Human GYG1 단백질을 인식하는 폴리클로날 항체로, Western Blot 및 Immunocytochemistry에 적합합니다. Rabbit 유래 IgG 형식이며 PrEST 항원으로 친화 정제되었습니다. PBS와 glycerol buffer에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073229-100 Anti-GYG1 Antibody, glycogenin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073229-25 Anti-GYG1 Antibody, glycogenin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GYG1 Antibody

Anti-GYG1 Antibody

Target Protein: glycogenin 1
Supplier: Atlas Antibodies

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human GYG1.

Alternative Gene Names

  • GYG

Open Datasheet

Target Information

항목 내용
Target Protein glycogenin 1
Target Gene GYG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000011146 (75%), Mouse ENSMUSG00000019528 (75%)

Antigen Sequence:
FLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Western Blot
Immunocytochemistry

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.