CacheBy
Atlas Antibodies Anti-GYG2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GYG2 Antibody

상품 한눈에 보기

인간 GYG2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 실험에 적합. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제됨. 인간 반응성 검증 완료, 안정적 보존용 버퍼 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064686-100 Anti-GYG2 Antibody, glycogenin 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064686-25 Anti-GYG2 Antibody, glycogenin 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GYG2 Antibody

Anti-GYG2 Antibody

Target Information

  • Target Protein: glycogenin 2
  • Target Gene: GYG2
  • Alternative Gene Names: GN-2
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human GYG2.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
PAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSASSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTLCHSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSL

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000011146 (33%)
  • Mouse ENSMUSG00000019528 (26%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.