CacheBy
Atlas Antibodies Anti-GYG2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GYG2 Antibody

상품 한눈에 보기

Human GYG2 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. GYG2의 대체명 GN-2로도 알려져 있으며, glycerol 기반 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA005495-100 Anti-GYG2 Antibody, glycogenin 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005495-25 Anti-GYG2 Antibody, glycogenin 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GYG2 Antibody

Anti-GYG2 Antibody

Target Information

  • Target Protein: glycogenin 2
  • Target Gene: GYG2
  • Alternative Gene Names: GN-2

Product Description

Polyclonal antibody against human GYG2 (glycogenin 2).
Recommended for use in immunohistochemistry (IHC) and western blot (WB) applications.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
  • Antigen Sequence:
    PAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSASSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTLCHSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000011146 (33%)
  • Mouse ENSMUSG00000019528 (26%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet
Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.