CacheBy
Atlas Antibodies Anti-GSTP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GSTP1 Antibody

상품 한눈에 보기

Human GSTP1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증에 적합합니다. PrEST 항원으로 친화 정제되었으며 높은 종 간 반응성을 보입니다. 안정적인 PBS/glycerol 버퍼에 보존되어 연구용으로 최적화된 품질을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019869-100 Anti-GSTP1 Antibody, glutathione S-transferase pi 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019869-25 Anti-GSTP1 Antibody, glutathione S-transferase pi 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GSTP1 Antibody

Anti-GSTP1 Antibody

Target: Glutathione S-transferase pi 1 (GSTP1)
Supplier: Atlas Antibodies

  • IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)

Product Description

Polyclonal antibody against human GSTP1.

Alternative Gene Names

FAEES3, GST3, GSTP

Open Datasheet

Target Information

항목 내용
Target Protein Glutathione S-transferase pi 1
Target Gene GSTP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000097830 (89%)
  • Rat ENSRNOG00000018237 (83%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent
Independent Validation Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.