원본
Atlas Antibodies Anti-GRM8 Antibody
상품 한눈에 보기
Human GRM8 단백질을 인식하는 토끼 폴리클로날 항체로, 대사성 글루타메이트 수용체 연구에 적합합니다. IHC 등 다양한 응용에 사용 가능하며, 고순도의 Affinity 정제 방식으로 제조되었습니다. Human, Rat, Mouse에 반응합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA051481-100 Anti-GRM8 Antibody, glutamate receptor, metabotropic 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051481-25 Anti-GRM8 Antibody, glutamate receptor, metabotropic 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GRM8 Antibody
Anti-GRM8 Antibody
Target Information
- Target Protein: Glutamate receptor, metabotropic 8
- Target Gene: GRM8
- Alternative Gene Names: GLUR8, GPRC1H, mGlu8, MGLUR8
Product Description
Polyclonal antibody against human GRM8.
Recommended for use in immunohistochemistry (IHC) and related assays.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
STEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000021468 | 95% |
| Mouse | ENSMUSG00000024211 | 95% |
Antibody Characteristics
| Parameter | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.