Atlas Antibodies Anti-WHAMM Antibody

상품 한눈에 보기

인간 WHAMM 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 다양한 종 간 교차 반응성이 확인되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040231-100 Anti-WHAMM Antibody, WAS protein homolog associated with actin, golgi membranes and microtubules 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040231-25 Anti-WHAMM Antibody, WAS protein homolog associated with actin, golgi membranes and microtubules 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

WAS protein homolog associated with actin, Golgi membranes and microtubules

Polyclonal Antibody against Human WHAMM

KIAA1971, WHDC1

항목	내용
Target Protein	WAS protein homolog associated with actin, Golgi membranes and microtubules
Target Gene	WHAMM
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	RALSSSSQAATHQNLGFRAPVKDDQPRPLVCESPAERPRDSLESFSCPGSMDEVLASLRHGRAPLRKVEVPAVRPPHASINEHILAAIR
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000045795 (54%), Rat ENSRNOG00000028113 (54%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand