Atlas Antibodies Anti-WIPF2 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA024467-100 | - | Atlas Antibodies HPA024467-100 Anti-WIPF2 Antibody, WAS/WASL interacting protein family, member 2 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA024467-25 | - | Atlas Antibodies HPA024467-25 Anti-WIPF2 Antibody, WAS/WASL interacting protein family, member 2 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-WIPF2 Antibody
WAS/WASL interacting protein family, member 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human WIPF2
Alternative Gene Names
WICH, WIRE
Target Protein
WAS/WASL interacting protein family, member 2
Target Gene
WIPF2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
PVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPP
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000038013 (99%)
Rat ENSRNOG00000027849 (97%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|