CacheBy
Atlas Antibodies Anti-WHAMM Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WHAMM Antibody

상품 한눈에 보기

WHAMM 단백질을 인식하는 사람 유래 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 호스트에서 생산되었으며, 고순도 Affinity 정제 방식으로 제조되었습니다. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA039690-100 Anti-WHAMM Antibody, WAS protein homolog associated with actin, golgi membranes and microtubules 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039690-25 Anti-WHAMM Antibody, WAS protein homolog associated with actin, golgi membranes and microtubules 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WHAMM Antibody

Anti-WHAMM Antibody

WAS 단백질과 관련된 actin, 골지막, 미세소관 연관 단백질에 대한 항체입니다.


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human WHAMM


Alternative Gene Names

  • KIAA1971
  • WHDC1

Open Datasheet


Target Information

항목 내용
Target Protein WAS protein homolog associated with actin, golgi membranes and microtubules
Target Gene WHAMM
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (54%), Rat (54%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

RALSSSSQAATHQNLGFRAPVKDDQPRPLVCESPAERPRDSLESFSCPGSMDEVLASLRHGRAPLRKVEVPAVRPPHASINEHILAAIR


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.