CacheBy
Atlas Antibodies Anti-WDFY3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WDFY3 Antibody

상품 한눈에 보기

인간 WDFY3 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 높은 종간 서열 유사성을 보여 인체 연구에 신뢰성 있는 결과를 제공합니다.

카탈로그번호
HPA048572-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048572-100 Anti-WDFY3 Antibody, WD repeat and FYVE domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048572-25 Anti-WDFY3 Antibody, WD repeat and FYVE domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WDFY3 Antibody

Anti-WDFY3 Antibody

WD repeat and FYVE domain containing 3

IHC (Immunohistochemistry)

Product Description

Polyclonal antibody against Human WDFY3.

Alternative Gene Names

  • ALFY
  • KIAA0993
  • ZFYVE25

Open Datasheet

Target Information

항목 내용
Target Protein WD repeat and FYVE domain containing 3
Target Gene WDFY3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (95%), Rat (89%)

Antigen Sequence

AWCTDSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQTRAHLQGPLSHPHPNPIEVRNYSRLKPGYRWERQLVFRSKLTMH

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.