CacheBy
Atlas Antibodies Anti-WDHD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WDHD1 Antibody

상품 한눈에 보기

WDHD1 단백질을 인식하는 토끼 폴리클로날 항체로, 인간 시료에 적합합니다. AND-1/CHTF4/CTF4 유전자 타깃. WB 등 다양한 응용에 사용 가능하며, PrEST 항원을 이용해 친화 정제되었습니다. 글리세롤/PBS 완충액에 보존되어 있습니다.

카탈로그번호
HPA000632-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000632-100 Anti-WDHD1 Antibody, WD repeat and HMG-box DNA binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000632-25 Anti-WDHD1 Antibody, WD repeat and HMG-box DNA binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WDHD1 Antibody

Anti-WDHD1 Antibody

WD repeat and HMG-box DNA binding protein 1

Western Blot (WB)

Product Description

Polyclonal antibody against human WDHD1.

Alternative Gene Names

AND-1, CHTF4, CTF4

Open Datasheet (PDF)

Target Information

  • Target Protein: WD repeat and HMG-box DNA binding protein 1
  • Target Gene: WDHD1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLLENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVE

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000037572) – 90%
  • Rat (ENSRNOG00000011167) – 86%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.