AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-WDFY3 Antibody
상품 한눈에 보기
인간 WDFY3 단백질을 인식하는 토끼 폴리클로날 항체로, WD repeat 및 FYVE 도메인을 포함한 단백질 연구에 적합. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원을 이용해 친화 정제됨. 인체 반응성이 검증된 고품질 연구용 항체.
- 카탈로그번호
- HPA042734-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042734-100 Anti-WDFY3 Antibody, WD repeat and FYVE domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042734-25 Anti-WDFY3 Antibody, WD repeat and FYVE domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-WDFY3 Antibody
Anti-WDFY3 Antibody
WD repeat and FYVE domain containing 3
Recommended Applications
면역조직화학(IHC) 등 다양한 응용에 사용 가능
Product Description
Polyclonal Antibody against Human WDFY3
Alternative Gene Names
ALFY, KIAA0993, ZFYVE25
Target Information
| 구분 | 내용 |
|---|---|
| Target Protein | WD repeat and FYVE domain containing 3 |
| Target Gene | WDFY3 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | AWCTDSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQTRAHLQGPLSHPHPNPIEVRNYSRLKPGYRWERQLVFRSKLTMH |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000043940 | 95% |
| Rat | ENSRNOG00000061121 | 89% |
Antibody Characteristics
| 구분 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.