Atlas Antibodies Anti-WBSCR22 Antibody

상품 한눈에 보기

Human WBSCR22 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 특이성(인간, 마우스, 랫트) 확인됨. 안정적인 PBS/glycerol buffer에 보존되어 연구용으로 최적화됨.

카탈로그번호: HPA052185-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA052185-100 Anti-WBSCR22 Antibody, Williams Beuren syndrome chromosome region 22 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA052185-25 Anti-WBSCR22 Antibody, Williams Beuren syndrome chromosome region 22 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-WBSCR22 Antibody

Anti-WBSCR22 Antibody

Target Information

Target Protein: Williams Beuren syndrome chromosome region 22
Target Gene: WBSCR22
Alternative Gene Names: MERM1, MGC19709, MGC2022, MGC5140, PP3381, WBMT

Product Description

Polyclonal antibody against human WBSCR22.
Validated for immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
ELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDE

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000005378	80%
Rat	ENSRNOG00000033700	80%

Antibody Properties

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet