CacheBy
Atlas Antibodies Anti-WBSCR22 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WBSCR22 Antibody

상품 한눈에 보기

Human WBSCR22 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 특이성(인간, 마우스, 랫트) 확인됨. 안정적인 PBS/glycerol buffer에 보존되어 연구용으로 최적화됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA052185-100 Anti-WBSCR22 Antibody, Williams Beuren syndrome chromosome region 22 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052185-25 Anti-WBSCR22 Antibody, Williams Beuren syndrome chromosome region 22 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WBSCR22 Antibody

Anti-WBSCR22 Antibody

Target Information

  • Target Protein: Williams Beuren syndrome chromosome region 22
  • Target Gene: WBSCR22
  • Alternative Gene Names: MERM1, MGC19709, MGC2022, MGC5140, PP3381, WBMT

Product Description

Polyclonal antibody against human WBSCR22.
Validated for immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
ELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000005378 80%
Rat ENSRNOG00000033700 80%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.