
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-WBSCR22 Antibody
상품 한눈에 보기
Human WBSCR22 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 특이성(인간, 마우스, 랫트) 확인됨. 안정적인 PBS/glycerol buffer에 보존되어 연구용으로 최적화됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA052185-100 Anti-WBSCR22 Antibody, Williams Beuren syndrome chromosome region 22 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052185-25 Anti-WBSCR22 Antibody, Williams Beuren syndrome chromosome region 22 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-WBSCR22 Antibody
Anti-WBSCR22 Antibody
Target Information
- Target Protein: Williams Beuren syndrome chromosome region 22
- Target Gene: WBSCR22
- Alternative Gene Names: MERM1, MGC19709, MGC2022, MGC5140, PP3381, WBMT
Product Description
Polyclonal antibody against human WBSCR22.
Validated for immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:ELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDE
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000005378 | 80% |
| Rat | ENSRNOG00000033700 | 80% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



