Atlas Antibodies Anti-VSIG10L Antibody

상품 한눈에 보기

Human VSIG10L 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도의 IgG 형태로 제공됩니다. 인간 단백질에 특이적으로 반응하며, 연구용으로 안정된 보존 용액에 포함되어 있습니다.

카탈로그번호: HPA066745-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA066745-100 Anti-VSIG10L Antibody, V-set and immunoglobulin domain containing 10 like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA066745-25 Anti-VSIG10L Antibody, V-set and immunoglobulin domain containing 10 like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-VSIG10L Antibody

Anti-VSIG10L Antibody

V-set and immunoglobulin domain containing 10 like

Recommended Applications

Immunohistochemistry (IHC)
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human VSIG10L.

Open Datasheet

Target Information

항목	내용
Target Protein	V-set and immunoglobulin domain containing 10 like
Target Gene	VSIG10L
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	VLTWDVERGALISSFEIQAWPDGPALGRTSTYRDWVSLLILGPQERSAVVPLPPRNPGTWTFRILPILGGQPGTPSQSRVY
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000023411 (78%), Mouse ENSMUSG00000070604 (77%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand