CacheBy
Atlas Antibodies Anti-VSIG10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VSIG10 Antibody

상품 한눈에 보기

Human VSIG10 단백질을 인식하는 Rabbit Polyclonal Antibody로, PrEST 항원을 사용해 친화 정제됨. 면역형광 등 다양한 응용에 적합하며, 인간 시료에 검증됨. 40% 글리세롤 및 PBS 완충액에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA062022-100 Anti-VSIG10 Antibody, V-set and immunoglobulin domain containing 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062022-25 Anti-VSIG10 Antibody, V-set and immunoglobulin domain containing 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VSIG10 Antibody

Anti-VSIG10 Antibody

V-set and immunoglobulin domain containing 10 (VSIG10)
Polyclonal antibody against Human VSIG10 protein.

  • Immunocytochemistry (ICC)

Product Description

  • Polyclonal Antibody against Human VSIG10
  • Verified species reactivity: Human
  • Supplied by Atlas Antibodies

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein V-set and immunoglobulin domain containing 10
Target Gene VSIG10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LTCQVSGAYPPAKILWLRNLTQPEVIIQPSSRHLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREMEIWLSVK

Interspecies Information

종 Ortholog ID 항원 서열 일치율
Rat ENSRNOG00000022698 74%
Mouse ENSMUSG00000066894 72%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.