AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-VSIG10 Antibody
상품 한눈에 보기
Human VSIG10 단백질을 인식하는 Rabbit Polyclonal Antibody로, PrEST 항원을 사용해 친화 정제됨. 면역형광 등 다양한 응용에 적합하며, 인간 시료에 검증됨. 40% 글리세롤 및 PBS 완충액에 보존제로 sodium azide 포함.
- 카탈로그번호
- HPA062022-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA062022-100 Anti-VSIG10 Antibody, V-set and immunoglobulin domain containing 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062022-25 Anti-VSIG10 Antibody, V-set and immunoglobulin domain containing 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-VSIG10 Antibody
Anti-VSIG10 Antibody
V-set and immunoglobulin domain containing 10 (VSIG10)
Polyclonal antibody against Human VSIG10 protein.
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
- Polyclonal Antibody against Human VSIG10
- Verified species reactivity: Human
- Supplied by Atlas Antibodies
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | V-set and immunoglobulin domain containing 10 |
| Target Gene | VSIG10 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LTCQVSGAYPPAKILWLRNLTQPEVIIQPSSRHLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREMEIWLSVK |
Interspecies Information
| 종 | Ortholog ID | 항원 서열 일치율 |
|---|---|---|
| Rat | ENSRNOG00000022698 | 74% |
| Mouse | ENSMUSG00000066894 | 72% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.