CacheBy
Atlas Antibodies Anti-VSIG4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VSIG4 Antibody

상품 한눈에 보기

인간 VSIG4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합합니다. PrEST 항원을 이용해 친화정제되었으며, RNA-seq 데이터와 비교한 단백질 발현 검증이 가능합니다. PBS/glycerol 버퍼에 보존되어 있습니다.

카탈로그번호
HPA003903-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003903-100 Anti-VSIG4 Antibody, V-set and immunoglobulin domain containing 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003903-25 Anti-VSIG4 Antibody, V-set and immunoglobulin domain containing 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VSIG4 Antibody

Anti-VSIG4 Antibody

V-set and immunoglobulin domain containing 4


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human VSIG4


Alternative Gene Names

Z39IG

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein V-set and immunoglobulin domain containing 4
Target Gene VSIG4
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence PPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYL
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000028763 (26%), Rat ENSRNOG00000021243 (25%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.