
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-VPS41 Antibody
상품 한눈에 보기
Human VPS41 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. 재조합 발현 검증을 통해 높은 특이성과 신뢰성을 확보. PrEST 항원을 이용한 친화 정제 방식으로 제조됨. PBS와 글리세롤 기반 버퍼로 안정화.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA020080-100 Anti-VPS41 Antibody, vacuolar protein sorting 41 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020080-25 Anti-VPS41 Antibody, vacuolar protein sorting 41 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-VPS41 Antibody
Anti-VPS41 Antibody
Target: vacuolar protein sorting 41 homolog (S. cerevisiae)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human VPS41.
Alternative Gene Names
- HVSP41
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | vacuolar protein sorting 41 homolog (S. cerevisiae) |
| Target Gene | VPS41 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLKKMHRTQMKGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSAKNRGPGSAILEM |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000041236 (97%), Rat ENSRNOG00000012940 (32%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



