CacheBy
Atlas Antibodies Anti-VPS45 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VPS45 Antibody

상품 한눈에 보기

인간 VPS45 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 고순도의 Affinity 정제 항체이며, 40% 글리세롤과 PBS 완충액에 보존됩니다. 인간에 반응하며, 설치류와 높은 서열 유사성을 가집니다.

카탈로그번호
HPA027425-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027425-100 Anti-VPS45 Antibody, vacuolar protein sorting 45 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027425-25 Anti-VPS45 Antibody, vacuolar protein sorting 45 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VPS45 Antibody

Anti-VPS45 Antibody

Target: vacuolar protein sorting 45 homolog (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human VPS45.

Alternative Gene Names

h-vps45, H1, VPS45A, VPS45B

Open Datasheet

Target Information

항목 내용
Target Protein vacuolar protein sorting 45 homolog (S. cerevisiae)
Target Gene VPS45
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
KETTGIVSMVYTQSEILQKEVYLFERIDSQNREIMKHLKAICFLRPTKENVDYIIQELRRPKYTIYFIYFSNVISKSDVKSLAEADEQEVVA
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000021173 (97%)
Mouse ENSMUSG00000015747 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.