CacheBy
Atlas Antibodies Anti-VPS37D Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VPS37D Antibody

상품 한눈에 보기

휴먼 VPS37D 단백질에 대한 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 사용해 친화 정제되었습니다. 사람, 쥐, 랫드에서 높은 교차 반응성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA040978-100 Anti-VPS37D Antibody, vacuolar protein sorting 37 homolog D (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040978-25 Anti-VPS37D Antibody, vacuolar protein sorting 37 homolog D (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VPS37D Antibody

Anti-VPS37D Antibody

Target: vacuolar protein sorting 37 homolog D (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human VPS37D.

Alternative Gene Names

MGC35352, WBSCR24

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein vacuolar protein sorting 37 homolog D (S. cerevisiae)
Target Gene VPS37D
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Amino Acid Sequence LRDLLQDEPKLDRIVRLSRKFQGLQLEREACLASNYALAKENLALRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHC

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000048699 (95%)
  • Mouse ENSMUSG00000043614 (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.