CacheBy
Atlas Antibodies Anti-VPS37B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VPS37B Antibody

상품 한눈에 보기

Human VPS37B 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 독립적 항체 검증 완료. VPS37B 단백질 발현 분석에 적합하며, 고순도의 친화 정제 항체. Human, Mouse, Rat에 반응.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038217-100 Anti-VPS37B Antibody, vacuolar protein sorting 37 homolog B (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038217-25 Anti-VPS37B Antibody, vacuolar protein sorting 37 homolog B (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VPS37B Antibody

Anti-VPS37B Antibody

Target: vacuolar protein sorting 37 homolog B (S. cerevisiae)


  • IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human VPS37B


Alternative Gene Names

  • FLJ12750

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein vacuolar protein sorting 37 homolog B (S. cerevisiae)
Target Gene VPS37B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence IEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPELAPTAPLPYPAP

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000066278 (83%)
  • Rat ENSRNOG00000001086 (82%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.