CacheBy
Atlas Antibodies Anti-VPS36 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VPS36 Antibody

상품 한눈에 보기

인간 VPS36 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 보장. 보존제 포함 PBS 버퍼에 40% 글리세롤로 안정화.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA039734-100 Anti-VPS36 Antibody, vacuolar protein sorting 36 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039734-25 Anti-VPS36 Antibody, vacuolar protein sorting 36 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VPS36 Antibody

Anti-VPS36 Antibody

Target: vacuolar protein sorting 36 homolog (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human VPS36.

Alternative Gene Names

C13orf9, CGI-145, Eap45

Open Datasheet

Target Information

  • Target Protein: vacuolar protein sorting 36 homolog (S. cerevisiae)
  • Target Gene: VPS36
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    AGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000012654 (94%)
  • Mouse ENSMUSG00000031479 (93%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.