CacheBy
Atlas Antibodies Anti-VPS36 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VPS36 Antibody

상품 한눈에 보기

Human VPS36 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 ICC 등 다양한 응용에 적합. Rabbit에서 생산된 IgG 항체로, PrEST 항원으로 친화 정제됨. 40% glycerol 기반 PBS buffer에 sodium azide 보존제 포함.

카탈로그번호
HPA043947-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043947-100 Anti-VPS36 Antibody, vacuolar protein sorting 36 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043947-25 Anti-VPS36 Antibody, vacuolar protein sorting 36 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VPS36 Antibody

Anti-VPS36 Antibody

Target: vacuolar protein sorting 36 homolog (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human VPS36.

Alternative Gene Names

C13orf9, CGI-145, Eap45

Open Datasheet

Target Information

항목 내용
Target Protein vacuolar protein sorting 36 homolog (S. cerevisiae)
Target Gene VPS36
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000012654 (94%), Mouse ENSMUSG00000031479 (93%)

Antigen Sequence:
AGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRG

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.