Atlas Antibodies Anti-UTS2B Antibody

상품 한눈에 보기

Human UTS2B 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용해 친화정제되었으며, 글리세롤 기반 버퍼에 보존제 첨가. 사람에 대한 반응성이 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA026992-100 Anti-UTS2B Antibody, urotensin 2B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA026992-25 Anti-UTS2B Antibody, urotensin 2B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

면역조직화학(IHC) 등 다양한 연구용 응용에 권장됩니다.

Polyclonal antibody against human UTS2B. Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.