
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-UTP6 Antibody
상품 한눈에 보기
인간 UTP6 단백질을 표적으로 하는 폴리클로날 항체로 IHC, WB, ICC 실험에 적합함. siRNA knockdown으로 유전적 검증 완료. 토끼 유래 IgG 항체이며 PrEST 항원을 이용해 친화 정제됨. 인간, 마우스, 랫트 반응성 확인.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055806-100 Anti-UTP6 Antibody, UTP6, small subunit (SSU) processome component, homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055806-25 Anti-UTP6 Antibody, UTP6, small subunit (SSU) processome component, homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UTP6 Antibody
Anti-UTP6 Antibody
UTP6, small subunit (SSU) processome component, homolog (yeast)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — genetically validated by siRNA knockdown
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human UTP6.
Alternative Gene Names
C17orf40, HCA66
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | UTP6, small subunit (SSU) processome component, homolog (yeast) |
| Target Gene | UTP6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000035575 (88%), Rat ENSRNOG00000014209 (86%) |
Antigen Sequence:
ARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAV
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



