CacheBy
Atlas Antibodies Anti-UTP6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UTP6 Antibody

상품 한눈에 보기

Human UTP6 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit IgG 형식이며 PrEST 항원으로 정제되었습니다. 인간, 마우스, 랫트 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA025936-100 Anti-UTP6 Antibody, UTP6, small subunit (SSU) processome component, homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA025936-25 Anti-UTP6 Antibody, UTP6, small subunit (SSU) processome component, homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UTP6 Antibody

Anti-UTP6 Antibody

UTP6, small subunit (SSU) processome component, homolog (yeast)

  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Genetic validation by siRNA knockdown
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human UTP6

Alternative Gene Names

C17orf40, HCA66

Open Datasheet

Target Information

항목 내용
Target Protein UTP6, small subunit (SSU) processome component, homolog (yeast)
Target Gene UTP6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000035575 (88%), Rat ENSRNOG00000014209 (86%)

Antigen Sequence

ARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Genetic Validation
Genetic Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.