Atlas Antibodies Anti-USP10 Antibody

상품 한눈에 보기

Human USP10 단백질을 인식하는 Rabbit polyclonal 항체로, IHC 및 WB에서 검증됨. siRNA knockdown을 통한 유전적 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성 보장. Human에 반응하며, USP10 단백질 발현 연구에 적합.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA006749-100 Anti-USP10 Antibody, ubiquitin specific peptidase 10 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA006749-25 Anti-USP10 Antibody, ubiquitin specific peptidase 10 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-USP10 Antibody

Anti-USP10 Antibody

Target: ubiquitin specific peptidase 10 (USP10)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Genetic validation): Genetic validation in WB by siRNA knockdown.
ICC: Validated for immunocytochemistry.

Product Description

Polyclonal Antibody against Human USP10

Alternative Gene Names

KIAA0190, UBPO

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	ubiquitin specific peptidase 10
Target Gene	USP10
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	KITPDGITKEASYGSIDCQYPGSALALDGSSNVEAEVLENDGVSGGLGQRERKKKKKRPPGYYSYLKDGGDDSISTEALVNGHANSAVPNSVSAEDAEFMGDMPPPLTPRTCNSPQNSTDS
Verified Species Reactivity	Human
Interspecies Identity	Rat (67%), Mouse (64%)