Atlas Antibodies Anti-USP11 Antibody

상품 한눈에 보기

Human USP11 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 분석에 적합합니다. Orthogonal validation을 통해 단백질 발현 검증이 이루어졌으며, PrEST 항원으로 친화 정제되었습니다. USP11 연구 및 단백질 발현 분석에 유용합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA003103-100 Anti-USP11 Antibody, ubiquitin specific peptidase 11 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA003103-25 Anti-USP11 Antibody, ubiquitin specific peptidase 11 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-USP11 Antibody

Anti-USP11 Antibody

Target: ubiquitin specific peptidase 11 (USP11)
Type: Polyclonal Antibody against Human USP11

Recommended Applications

IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against Human USP11. Validated for use in IHC and ICC.

Alternative Gene Names

UHX1

Target Information

항목	내용
Target Protein	ubiquitin specific peptidase 11
Target Gene	USP11
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	ESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFS