CacheBy
Atlas Antibodies Anti-USP14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-USP14 Antibody

상품 한눈에 보기

인간 USP14 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 토끼 유래 IgG 형태이며, PrEST 항원으로 정제되었습니다. 인간, 마우스, 랫트에 반응하며 높은 종간 일치도를 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001308-100 Anti-USP14 Antibody, ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001308-25 Anti-USP14 Antibody, ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-USP14 Antibody

Anti-USP14 Antibody

Target: Ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human USP14.

Alternative Gene Names

  • TGT

Open Datasheet

Target Information

  • Target Protein: Ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
  • Target Gene: USP14

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVL

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000047879 94%
Rat ENSRNOG00000014981 94%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.