Atlas Antibodies Anti-USP1 Antibody

상품 한눈에 보기

휴먼 USP1 단백질을 타깃으로 하는 폴리클로날 항체. WB 및 ICC에 적합하며, 독립 항체 비교를 통한 검증 완료. 토끼 유래 IgG 형식으로 PrEST 항원 친화 정제. 휴먼에 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028440-100 Anti-USP1 Antibody, ubiquitin specific peptidase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028440-25 Anti-USP1 Antibody, ubiquitin specific peptidase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Ubiquitin specific peptidase 1 (USP1)
Supplier: Atlas Antibodies

WB (Western Blot): Independent antibody validation by comparing antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal antibody against human USP1.

항목	내용
Target Protein	Ubiquitin specific peptidase 1
Target Gene	USP1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat (92%), Mouse (89%)

Antigen Sequence:
HSGITISSGHYTASVKVTDLNSLELDKGNFVVDQMCEIGKPEPLNEEEARGVVENYNDEEVSIRVGGNTQPSKVLNKKNVEAIGLLGGQKSKADYELYN

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand