CacheBy
Atlas Antibodies Anti-USP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-USP1 Antibody

상품 한눈에 보기

휴먼 USP1 단백질을 타깃으로 하는 폴리클로날 항체. WB 및 ICC에 적합하며, 독립 항체 비교를 통한 검증 완료. 토끼 유래 IgG 형식으로 PrEST 항원 친화 정제. 휴먼에 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028440-100 Anti-USP1 Antibody, ubiquitin specific peptidase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028440-25 Anti-USP1 Antibody, ubiquitin specific peptidase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-USP1 Antibody

Anti-USP1 Antibody

Target: Ubiquitin specific peptidase 1 (USP1)
Supplier: Atlas Antibodies


  • WB (Western Blot): Independent antibody validation by comparing antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human USP1.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Ubiquitin specific peptidase 1
Target Gene USP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (92%), Mouse (89%)

Antigen Sequence:
HSGITISSGHYTASVKVTDLNSLELDKGNFVVDQMCEIGKPEPLNEEEARGVVENYNDEEVSIRVGGNTQPSKVLNKKNVEAIGLLGGQKSKADYELYN


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.