Atlas Antibodies Anti-USP1 Antibody

상품 한눈에 보기

Human USP1 단백질을 인식하는 토끼 다클론 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며 높은 특이성과 재현성을 제공합니다. 인간에 대한 검증 완료, 라트 및 마우스와 높은 서열 유사성을 가집니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028387-100 Anti-USP1 Antibody, ubiquitin specific peptidase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028387-25 Anti-USP1 Antibody, ubiquitin specific peptidase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: ubiquitin specific peptidase 1 (USP1)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG

WB (Western Blot) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal antibody against human USP1.
Open Datasheet (PDF)

항목	내용
Target Protein	ubiquitin specific peptidase 1
Target Gene	USP1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	HSGITISSGHYTASVKVTDLNSLELDKGNFVVDQMCEIGKPEPLNEEEARGVVENYNDEEVSIRVGGNTQPSKVLNKKNVEAIGLLGGQKSKADYELYN

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000007890	92%
Mouse	ENSMUSG00000028560	89%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative)
MSDS	Material Safety Data Sheet