CacheBy
Thermo Fisher Scientific HMG4 Monoclonal Antibody (7G13)
원본

Thermo Fisher Scientific HMG4 Monoclonal Antibody (7G13)

상품 한눈에 보기

Human HMG4 단백질을 표적으로 하는 Mouse IgG2b 단클론 항체. Western blot, IHC, ICC/IF, Flow cytometry에 적합. 합성 펩타이드 항원으로 제작되어 높은 특이성과 재현성을 제공. 연구용으로만 사용 가능.

카탈로그번호
MA536230
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 04:03
Thermo Fisher Scientific MA536230 HMG4 Monoclonal Antibody (7G13) 100 ug pk판매 단위 pk ·
재고 확인 필요
680,400원VAT 포함 748,440원

Thermo Fisher Scientific · Thermo Fisher Scientific HMG4 Monoclonal Antibody (7G13)

Applications 및 Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL
Immunocytochemistry (ICC/IF) 2 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Clone 7G13
Immunogen Synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62–95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Affinity chromatography
Storage buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage conditions Store at 4°C short term. For long term storage, store at −20°C, avoiding freeze/thaw cycles.
Shipping conditions Wet ice
RRID AB_2884064

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

HMGB3 belongs to the high mobility group protein superfamily. Like HMG1 and HMG2, HMGB3 contains DNA-binding HMG box domains and is classified into the HMG box subfamily. Members of this subfamily play fundamental roles in DNA replication, nucleosome assembly, and transcription.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.