
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-UPP2 Antibody
상품 한눈에 보기
Human UPP2 단백질을 인식하는 고품질 폴리클로날 항체로, WB 및 ICC 실험에 적합합니다. Recombinant expression 검증 완료. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간 반응성이 검증된 연구용 시약입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035226-100 Anti-UPP2 Antibody, uridine phosphorylase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035226-25 Anti-UPP2 Antibody, uridine phosphorylase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UPP2 Antibody
Anti-UPP2 Antibody
Target Protein: uridine phosphorylase 2
Supplier: Atlas Antibodies
Recommended Applications
- WB (Recombinant expression validation using target protein overexpression)
- ICC
Product Description
Polyclonal antibody against Human UPP2
Alternative Gene Names: UDRPASE2, UP2, UPASE2
Open Datasheet (PDF)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
GIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLVGHTMCT
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000005341 (87%)
- Mouse ENSMUSG00000026839 (87%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



