Atlas Antibodies Anti-UNC93B1 Antibody

상품 한눈에 보기

Human UNC93B1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, WB 및 ICC에 적합. Orthogonal validation으로 단백질 발현 검증. 고순도 Affinity 정제. 40% glycerol 기반 안정한 보존 용액 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038716-100 Anti-UNC93B1 Antibody, unc-93 homolog B1 (C. elegans) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038716-25 Anti-UNC93B1 Antibody, unc-93 homolog B1 (C. elegans) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: unc-93 homolog B1 (C. elegans)
Supplier: Atlas Antibodies

WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal antibody against Human UNC93B1.

항목	내용
Target Protein	unc-93 homolog B1 (C. elegans)
Target Gene	UNC93B1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	NYITRMAQKYHEYSHYKEQDGQGMKQRPPRGSHAPY
Verified Species Reactivity	Human
Interspecies Homology	Rat ENSRNOG00000017703 (86%), Mouse ENSMUSG00000036908 (86%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)