Atlas Antibodies Anti-UNK Antibody

상품 한눈에 보기

Human UNK 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 사용 가능. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성(마우스 90%, 랫 89%)을 보임. 40% 글리세롤과 PBS 버퍼에 보존됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027962-100 Anti-UNK Antibody, unkempt family zinc finger 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027962-25 Anti-UNK Antibody, unkempt family zinc finger 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human UNK protein.

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
DAWKKEAEEAGERASAAGAECELAREQRDALEVQVKKLQEELERLHAGPEPQALPAFSDLEALSLSTLYSLQKQLRAHLEQVDKAVFHMQSVKCLKCQEQKRAVL

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Applications	Recommended for IHC and related assays
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.