CacheBy
Atlas Antibodies Anti-UNC93B1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UNC93B1 Antibody

상품 한눈에 보기

Human UNC93B1 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, RNA-seq 데이터 기반 정교한 검증을 거쳤습니다. 인간에 대한 반응성이 확인되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042803-100 Anti-UNC93B1 Antibody, unc-93 homolog B1 (C. elegans) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042803-25 Anti-UNC93B1 Antibody, unc-93 homolog B1 (C. elegans) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UNC93B1 Antibody

Anti-UNC93B1 Antibody

Target: unc-93 homolog B1 (C. elegans)
Supplier: Atlas Antibodies


  • Western Blot (WB) – Orthogonal validation of protein expression using comparison to RNA-seq data in high and low expression cell lines.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human UNC93B1.

Alternative Gene Names: UNC93

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein unc-93 homolog B1 (C. elegans)
Target Gene UNC93B1
Antigen Sequence NYITRMAQKYHEYSHYKEQDGQGMKQRPPRGSHAPY
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000017703 (86%)
  • Mouse ENSMUSG00000036908 (86%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Orthogonal Validation
Orthogonal Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.