CacheBy
Atlas Antibodies Anti-ULK2 Antibody
원본

Atlas Antibodies Anti-ULK2 Antibody

상품 한눈에 보기

ULK2 단백질을 표적으로 하는 인간 유래 폴리클로날 항체입니다. Rabbit 호스트에서 생산되었으며, Western Blot 등 다양한 연구용 응용에 적합합니다. PrEST 항원으로 특이적 정제되어 높은 특이성과 재현성을 제공합니다. PBS/glycerol buffer로 안정화되어 장기 보관이 용이합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA009027-100 Anti-ULK2 Antibody, unc-51 like autophagy activating kinase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009027-25 Anti-ULK2 Antibody, unc-51 like autophagy activating kinase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ULK2 Antibody

Anti-ULK2 Antibody

Target Information

  • Target Protein: unc-51 like autophagy activating kinase 2
  • Target Gene: ULK2
  • Alternative Gene Names: ATG1B, KIAA0623, Unc51.2

Product Description

Polyclonal antibody against human ULK2.

Western Blot (WB)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VVRRSNTSPMGFLRPGSCSPVPADTAQTVGRRLSTGSSRPYSPSPLVGTIPEQFSQCCCGHPQGHDSRSRNSSGSPVPQAQSPQSLLSGARLQSAPTLTDIYQNKQKLRKQHSDPVCPSHTGAGYSYSPQPSRPGSLGTSPTKH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000002763 (93%)
  • Mouse ENSMUSG00000004798 (92%)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Recommended Applications - WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.