CacheBy
Atlas Antibodies Anti-ULK1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ULK1 Antibody

상품 한눈에 보기

ULK1 단백질을 인식하는 인간 유래 폴리클로날 항체로, 오토파지 관련 연구에 적합합니다. Rabbit IgG 형식이며, Human에 대한 반응성이 검증되었습니다. PrEST 항원으로 친화 정제되었으며, PBS/glycerol 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063990-100 Anti-ULK1 Antibody, unc-51 like autophagy activating kinase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063990-25 Anti-ULK1 Antibody, unc-51 like autophagy activating kinase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ULK1 Antibody

Anti-ULK1 Antibody

Target Information

  • Target Protein: unc-51 like autophagy activating kinase 1
  • Target Gene: ULK1
  • Alternative Gene Names: ATG1, ATG1A

Product Description

Polyclonal antibody against human ULK1, suitable for autophagy-related research.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCRNLRGSPKLPDFLQRNP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000029512 (87%)
  • Rat ENSRNOG00000037505 (87%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet

ICC (Immunocytochemistry)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.