CacheBy
Atlas Antibodies Anti-ULK3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ULK3 Antibody

상품 한눈에 보기

Human ULK3 단백질을 인식하는 폴리클로날 항체로, WB 및 IHC 실험에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. Human, Mouse, Rat 종에 반응성이 검증되었습니다.

카탈로그번호
HPA040474-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040474-100 Anti-ULK3 Antibody, unc-51 like kinase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040474-25 Anti-ULK3 Antibody, unc-51 like kinase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ULK3 Antibody

Anti-ULK3 Antibody

Target Information

  • Target Protein: unc-51 like kinase 3
  • Target Gene: ULK3
  • Alternative Gene Names: DKFZP434C131, FLJ90566

Product Description

Polyclonal antibody against human ULK3.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ILKGIRHPHIVQLKDFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQLASALQFLHERNISHLDLKPQNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYMAPEMVCQRQYDARVDLWSMGVILYGETSFPC

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000038459 (93%)
  • Mouse ENSMUSG00000032308 (93%)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Verified Reactivity Human, Mouse, Rat
Applications IHC, WB

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference Documents

제품 이미지

IHC Application Icon
WB Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.