CacheBy
Atlas Antibodies Anti-UBR7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UBR7 Antibody

상품 한눈에 보기

Human UBR7 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 상동성을 보임. 40% glycerol/PBS buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000861-100 Anti-UBR7 Antibody, ubiquitin protein ligase E3 component n-recognin 7 (putative) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000861-25 Anti-UBR7 Antibody, ubiquitin protein ligase E3 component n-recognin 7 (putative) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UBR7 Antibody

Anti-UBR7 Antibody

Target: ubiquitin protein ligase E3 component n-recognin 7 (putative)
Supplier: Atlas Antibodies
Type: Polyclonal Antibody against Human UBR7


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting the human UBR7 protein (ubiquitin protein ligase E3 component n-recognin 7, putative).


Alternative Gene Names

  • C14orf130

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ubiquitin protein ligase E3 component n-recognin 7 (putative)
Target Gene UBR7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000008108 (96%), Mouse ENSMUSG00000041712 (94%)

Antigen Sequence:
RQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALYACSTCTPEGEEPAGICLACSYECHGSHKLFELYTKRNFRCDCGNSKFKNLECKLLPDKAKVNSGNKYNDNFFGLYCICKRPYPDPEDEI


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.