CacheBy
Atlas Antibodies Anti-UBR2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UBR2 Antibody

상품 한눈에 보기

Human UBR2 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제됨. 인간에 대한 반응성이 검증됨. 최적 조건은 사용자 실험에 따라 결정.

카탈로그번호
HPA027869-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027869-100 Anti-UBR2 Antibody, ubiquitin protein ligase E3 component n-recognin 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027869-25 Anti-UBR2 Antibody, ubiquitin protein ligase E3 component n-recognin 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UBR2 Antibody

Anti-UBR2 Antibody

Target: ubiquitin protein ligase E3 component n-recognin 2
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal Antibody against Human UBR2


Alternative Gene Names

bA49A4.1, C6orf133, dJ392M17.3, KIAA0349

Open Datasheet


Target Information

항목 내용
Target Protein ubiquitin protein ligase E3 component n-recognin 2
Target Gene UBR2
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000015813 (65%), Mouse ENSMUSG00000023977 (59%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QPNLTQWIRTISQQIKALQFLRKEESTPNNASTKNSENVDELQLPEGFRPDFRPKIPYSESIKEMLTTFGTATYKVGLKVHPN

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.