CacheBy
Atlas Antibodies Anti-TXNRD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TXNRD2 Antibody

상품 한눈에 보기

Human TXNRD2 단백질을 인식하는 Rabbit Polyclonal 항체로 IHC 및 WB에 적합. PrEST 항원으로 친화 정제되었으며, 40% glycerol/PBS buffer로 안정화. 인간에 특이적 반응성을 가지며, 마우스 및 랫트와 80% 서열 유사성.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003323-100 Anti-TXNRD2 Antibody, thioredoxin reductase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003323-25 Anti-TXNRD2 Antibody, thioredoxin reductase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TXNRD2 Antibody

Anti-TXNRD2 Antibody

Target: Thioredoxin reductase 2 (TXNRD2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human TXNRD2.


Alternative Gene Names

TR, TR3, TRXR2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Thioredoxin reductase 2
Target Gene TXNRD2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000099282 (80%), Rat ENSRNOG00000001890 (80%)

Antigen Sequence:
CAGFLTGIGLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDSTTGKEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREATSVPHIYAIGDVVEGRPELTPTAIMAGRLLVQRLF


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.