
원본
Atlas Antibodies Anti-TXNIP Antibody
상품 한눈에 보기
인간 TXNIP 단백질을 인식하는 고품질 폴리클로날 항체로, Rabbit에서 생산되었습니다. IHC 및 WB에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 대한 반응성이 검증되어 연구용으로 최적화되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053694-100 Anti-TXNIP Antibody, thioredoxin interacting protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053694-25 Anti-TXNIP Antibody, thioredoxin interacting protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TXNIP Antibody
Anti-TXNIP Antibody
Target: Thioredoxin Interacting Protein (TXNIP)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human TXNIP.
Alternative Gene Names
EST01027, HHCPA78, THIF, VDUP1
Antigen Information
- Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Sequence:
FEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGENEM
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000021201 | 96% |
| Mouse | ENSMUSG00000038393 | 96% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



