CacheBy
Atlas Antibodies Anti-TXNRD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TXNRD1 Antibody

상품 한눈에 보기

Human TXNRD1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 분석에 적합하며, RNA-seq 데이터 기반 Orthogonal 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체로 다양한 종 간 교차 반응 정보 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043871-100 Anti-TXNRD1 Antibody, thioredoxin reductase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043871-25 Anti-TXNRD1 Antibody, thioredoxin reductase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TXNRD1 Antibody

Anti-TXNRD1 Antibody

Target Protein: Thioredoxin reductase 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human TXNRD1


Alternative Gene Names

GRIM-12, Trxr1, TXNR

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein Thioredoxin reductase 1
Target Gene TXNRD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000020250 (59%)
Rat ENSRNOG00000059810 (59%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

SCEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYG

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal Application
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.