CacheBy
Atlas Antibodies Anti-TXNRD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TXNRD1 Antibody

상품 한눈에 보기

Human TXNRD1 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 WB 분석에 적합. PrEST 항원을 이용해 친화 정제됨. Orthogonal validation으로 RNA-seq 데이터 기반 단백질 발현 검증. 고품질 글리세롤 기반 PBS 버퍼로 안정적 보존.

카탈로그번호
HPA001395-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001395-100 Anti-TXNRD1 Antibody, thioredoxin reductase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001395-25 Anti-TXNRD1 Antibody, thioredoxin reductase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TXNRD1 Antibody

Anti-TXNRD1 Antibody

Target Protein: Thioredoxin reductase 1 (TXNRD1)

  • Immunohistochemistry (IHC)
  • Western Blot (WB, Orthogonal validation)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody against human TXNRD1.

Alternative Gene Names

  • GRIM-12
  • Trxr1
  • TXNR

Open Datasheet (PDF)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SCEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYG

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000059810 59%
Mouse ENSMUSG00000020250 59%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet (MSDS)


제품 이미지

Enhanced Validation
Recommended Applications - IHC
Recommended Applications - WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.