Atlas Antibodies Anti-TTC26 Antibody

상품 한눈에 보기

Human TTC26 단백질을 인식하는 고특이적 폴리클로날 항체. IHC 및 RNA-seq 데이터 기반의 Orthogonal Validation 수행. Rabbit에서 생산된 IgG 항체로, PrEST 항원으로 친화 정제됨. 다양한 조직에서 TTC26 발현 연구에 적합.

카탈로그번호: HPA036338-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036338-100 Anti-TTC26 Antibody, tetratricopeptide repeat domain 26 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036338-25 Anti-TTC26 Antibody, tetratricopeptide repeat domain 26 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TTC26 Antibody

Anti-TTC26 Antibody

Target: tetratricopeptide repeat domain 26 (TTC26)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human TTC26

Alternative Gene Names

dyf-13
DYF13
FLJ12571

Open Datasheet

Target Information

항목	내용
Target Protein	tetratricopeptide repeat domain 26
Target Gene	TTC26
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000056832 (93%), Rat ENSRNOG00000027617 (93%)

Antigen Sequence:
GVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAH

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet