CacheBy
Atlas Antibodies Anti-TTC29 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TTC29 Antibody

상품 한눈에 보기

Human TTC29 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 보존용으로 40% glycerol과 sodium azide가 포함되어 있습니다.

카탈로그번호
HPA037006-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037006-100 Anti-TTC29 Antibody, tetratricopeptide repeat domain 29 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037006-25 Anti-TTC29 Antibody, tetratricopeptide repeat domain 29 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TTC29 Antibody

Anti-TTC29 Antibody

Target Information

  • Target Protein: Tetratricopeptide repeat domain 29
  • Target Gene: TTC29
  • Alternative Gene Names: NYD-SP14

Product Description

Polyclonal antibody against Human TTC29.

면역조직화학 (IHC) 등 다양한 연구용 응용에 적합합니다.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    IDCGKKEAEAHMHMGLLYEEDGQLLEAAEHYEAFHQLTQGRIWKDETGRSLNLLACESLLRTYRLLSDKMLENKEYKQAIKILIKA

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000037101 79%
Rat ENSRNOG00000012342 79%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자에 의해 결정되어야 합니다.

Reference

Open Datasheet

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.