CacheBy
Atlas Antibodies Anti-TTC30A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TTC30A Antibody

상품 한눈에 보기

Human TTC30A 단백질을 인식하는 토끼 폴리클로날 항체로, WB, IHC, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보임. 40% 글리세롤 및 PBS 버퍼에 보존제로 나트륨 아지드가 포함됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051714-100 Anti-TTC30A Antibody, tetratricopeptide repeat domain 30A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051714-25 Anti-TTC30A Antibody, tetratricopeptide repeat domain 30A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TTC30A Antibody

Anti-TTC30A Antibody

Target Information

  • Target Protein: tetratricopeptide repeat domain 30A
  • Target Gene: TTC30A
  • Alternative Gene Names: FLJ13946, IFT70A

Product Description

Polyclonal antibody against human TTC30A.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

FRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000059460 (98%)
  • Mouse ENSMUSG00000075273 (97%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.