CacheBy
Atlas Antibodies Anti-GPR152 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GPR152 Antibody

상품 한눈에 보기

Human GPR152 단백질을 인식하는 Rabbit Polyclonal Antibody. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 적합. PBS/glycerol buffer로 안정적 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035078-100 Anti-GPR152 Antibody, G protein-coupled receptor 152 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035078-25 Anti-GPR152 Antibody, G protein-coupled receptor 152 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GPR152 Antibody

Anti-GPR152 Antibody

제품 개요

Polyclonal Antibody against Human GPR152
(G protein-coupled receptor 152)

추천 응용 분야

  • Immunohistochemistry (IHC)
  • 기타 연구용 응용

대체 유전자명

  • PGR5

Open Datasheet

표적 정보

항목 내용
Target Protein G protein-coupled receptor 152
Target Gene GPR152
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000097905 (60%), Rat ENSRNOG00000021912 (60%)

Antigen Sequence:
DLRTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQSQMDPVAQPQVNPTLQPRSDPTAQPQLNPTAQ

항체 정보

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer 구성

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet

주의사항

  • 사용 전 부드럽게 혼합하세요.
  • 각 응용에 맞는 최적의 농도와 조건은 사용자가 결정해야 합니다.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.