CacheBy
Atlas Antibodies Anti-GPR155 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GPR155 Antibody

상품 한눈에 보기

인간 GPR155 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 응용에 적합합니다. 토끼 유래 IgG 형태이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 특이적으로 반응하며 높은 종간 서열 동일성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036159-100 Anti-GPR155 Antibody, G protein-coupled receptor 155 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036159-25 Anti-GPR155 Antibody, G protein-coupled receptor 155 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GPR155 Antibody

Anti-GPR155 Antibody

Target Information

  • Target Protein: G protein-coupled receptor 155
  • Target Gene: GPR155
  • Alternative Gene Names: DEP.7, DEPDC3, FLJ31819, PGR22

면역조직화학 (IHC) 등 다양한 면역학적 분석에 적합합니다.

Product Description

Polyclonal antibody against human GPR155.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
HLIILPFKRRLEFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVSW

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000018485 (92%)
  • Mouse ENSMUSG00000041762 (89%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 결정해야 합니다.

Additional Resources

제품 이미지

Recommended Applications: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.